PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_17762A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family Nin-like
Protein Properties Length: 849aa    MW: 93344.5 Da    PI: 6.2775
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_17762AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.81.1e-28501552152
                     RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                                aek+isl++l++yFs+++k+AAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  Oropetium_20150105_17762A 501 AEKTISLDVLQQYFSGSLKNAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 552
                                589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.564491572IPR003035RWP-RK domain
PfamPF020425.8E-26504552IPR003035RWP-RK domain
SuperFamilySSF542774.91E-21744839No hitNo description
SMARTSM006665.1E-24754836IPR000270PB1 domain
PfamPF005641.4E-15754835IPR000270PB1 domain
PROSITE profilePS5174518.607754836IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2406.1E-25754835No hitNo description
CDDcd064073.47E-33755835No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0010118Biological Processstomatal movement
GO:0010167Biological Processresponse to nitrate
GO:0042128Biological Processnitrate assimilation
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 849 aa     Download sequence    Send to blast
MDLDPSPPSA PGDACGSGDA WPFDSLTTSL LFSSVSASSP VAQINHKWQL HLSLDEDSAD  60
NSSLFKEKLT QALRYFKDST DQHLLVQVWA PVKNGDRYVL TTSGQPFVLD QQSIGLLQYR  120
AVSMMYMFSV DGNNAGELGL PGRVYKQKVP EWTPNVQFYS SNEYPRLNHA ISYNVHGTVA  180
LPVFDPSAQS CIAVVELIMT SVKINYACEV DKVCKALEAV NLKSTEIFDH PNVQICNEGR  240
QAALVEILEI LTVVCEEHKL PLAQTWVPCK YRSVLAHGGG LKKSCLSFDG SCMGEVCMST  300
SDVAFQVIDA RMWGFRDACV EHHLQRGQGV SGKAFVSHKP CFSKDIRQFC KFEYPLVHYA  360
RMFGLAGCFA ICLQSSYTGH DDYILEFFLP PDCIDENDQN ALLESILTRM KRCLRSLKKD  420
LKIDTSEGCL HESPEGDTHG HVQKFDTENK SVSNMPEGQM LAGDYSQENG TSATRLNGSG  480
ASDSSLLHKN NKPSERKRGK AEKTISLDVL QQYFSGSLKN AAKSLGVCPT TMKRICRQHG  540
ISRWPSRKIN KVNRSLSKLK QVIESVQGSD AAFNLTSITG SLPIPVGPSS DSLNVEKVTQ  600
SKVAELSNPT ADGDRDCSLQ KSFENDHNFG IFMSHQGLMD NNNNAQLEAD KASESRSSSG  660
EGSINSRTSE GSCQGSPANQ TFVCKPIAST FAEPQINPEE CIKEPFQEPQ LPLSRLLIED  720
SGSSKDLKNL FTSTAEQPIF APPSNLMSMK HSGTITIKAS FKEDIVRFRF PCSSSVTVLK  780
DEVAKRLRMD VGMFDIKYLD DDHEWVKLAC NADLEECMEI SRHSGSHVIR LLVSDIAAHF  840
GSSCGSSG*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00449DAPTransfer from AT4G24020Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0853590.0BT085359.2 Zea mays full-length cDNA clone ZM_BFc0002J20 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002457049.10.0hypothetical protein SORBIDRAFT_03g000490
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLC5XJJ30.0C5XJJ3_SORBI; Putative uncharacterized protein Sb03g000490
STRINGSb03g000490.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7